PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G30770.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 831aa    MW: 93868.3 Da    PI: 6.8657
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G30770.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.72.8e-504615891129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtd el v+yLk+k+ gk+l++ ++++e+d+yk+ PwdLp k +++++++ewyfF++rd+ky++g+r+nr+t++gyWkatgkd++v
  OGLUM04G30770.2 461 LPPGFRFHPTDVELTVYYLKRKLLGKHLRC-NAVSELDLYKFAPWDLPeKsSLQSKDREWYFFCPRDRKYSSGSRTNRSTEAGYWKATGKDRPV 553
                      79****************************.89**************95357788999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +  ++++vg+k+tLvf+ g+ p+g +tdWvm eyrle
  OGLUM04G30770.2 554 IY-NSQTVGMKRTLVFHLGKPPRGDRTDWVMYEYRLE 589
                      **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF030164.0E-4253340IPR004263Exostosin-like
SuperFamilySSF1019418.24E-61452611IPR003441NAC domain
PROSITE profilePS5100556.488461611IPR003441NAC domain
PfamPF023656.1E-26462588IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005768Cellular Componentendosome
GO:0005802Cellular Componenttrans-Golgi network
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
MRSSHQPLCT RAHQAAALLL VAATFFLTRL LDRSPLSAPP PPCAAPYSPW PHRDLRIYVY  60
AEDEVDGLRA LLRGRNDDVT AATCIKGQWG TQVKIHQLLL SSRFRTFDKD EADLFFVPTY  120
VKCVRMTGKL NDKEINQTYV KVVLSQMPYF RRSGGRDHIF VFPSGAGAHL FRSWATFLNR  180
SIILTPEGDR TDKRGISAFN TWKDIIIPGN VDDSMVKSDR LAVKPIPLTK RKYLANFLGR  240
AQGKVGRLQL VKLAKQYPDK LESPELKLSG PDKLGRIDYF KHLRNAKFCL APRGESSWTL  300
RFYESFFVEC VPVILSDEVE LPFQNVIDYT EVSIKWPASK IGPGLLEYLE SIPDGRVEEM  360
IGRGREIRCL WVYAADTERC SAMSAIMWEL QRKVRRFHQS AETFWLHNRS IVNRDLVEFH  420
EWRTPHHHLL SAAAPHFLPS PTATTSYRQR SILLSMAKTS LPPGFRFHPT DVELTVYYLK  480
RKLLGKHLRC NAVSELDLYK FAPWDLPEKS SLQSKDREWY FFCPRDRKYS SGSRTNRSTE  540
AGYWKATGKD RPVIYNSQTV GMKRTLVFHL GKPPRGDRTD WVMYEYRLED KELSASGVKL  600
DACVLCKIFQ KSGPGPKIGE QYGAPFNEDD WNEANGELSS FAFSVPPCAL ESSNGRLNTA  660
GQQLAVSDNI GSSLDHCSET NDKIAVGGCG TTSPSVPFDT IHTQQLAEII SCFSTDLLNS  720
VSRDGSLPDS TADYDNDNEV SSDDGEAIFN ELDELDSQSD ESISNHCNSC GEDLIPPTLE  780
VLKTEQYLEL NDLSFSLADD PDPCNLLLTT NLSDQNHPEL ETSSNRKALR L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4945761211169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0646460.0AK064646.1 Oryza sativa Japonica Group cDNA clone:002-114-D03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697732.10.0PREDICTED: probable glucuronosyltransferase Os03g0107900
TrEMBLA0A0D9ZSW80.0A0A0D9ZSW8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA015889-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.47e-78NAC domain containing protein 82